Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_20664
Common NameKK1_021281
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 687aa    MW: 75750.1 Da    PI: 6.7516
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_20664genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
       Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                   +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
                   688999***********************************************999 PP

          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                    ela++a++elvk+a+ +ep+Wv+ +    e++n +e++++f++  +     + +ea r+ g+v+ ++  lve+l+d++ +W e+++    + +t+e
                    5899**************************************9999****9***************************.***************** PP

          START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    vis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+ds ++ +  + +v +++lpSg+++++++ng+skvtwveh+++
                    ***********************************************************999********************************** PP

          START 173 kgrlphwllrslvksglaegaktwvatlqrqcek 206
                    +++++h+l+r+l++sg+ +g ++wvatlqrqce+
                    ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.21640100IPR001356Homeobox domain
SMARTSM003899.9E-1841104IPR001356Homeobox domain
CDDcd000861.89E-1842100No hitNo description
PfamPF000461.1E-184398IPR001356Homeobox domain
PROSITE patternPS0002707598IPR017970Homeobox, conserved site
PROSITE profilePS5084844.574195431IPR002913START domain
SuperFamilySSF559614.4E-33198428No hitNo description
CDDcd088757.14E-127199427No hitNo description
SMARTSM002344.1E-49204428IPR002913START domain
PfamPF018524.4E-57204428IPR002913START domain
SuperFamilySSF559611.1E-24449673No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014516480.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
RefseqXP_014516481.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A151UCG50.0A0A151UCG5_CAJCA; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGGLYMA07G08340.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein